Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003559) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Affibody anti-CD69 Z(CD69:10)
|
|||||
| Synonyms |
Affibody Z(CD69:10)
|
|||||
| Molecular Weight | 8.5 kDa | |||||
| Thermal Denaturation TEMP | 60 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli BL21 (DE3) | |||||
| Selection Method | Escherichia coli display | |||||
| Highest Status | Research | |||||
| Sequence Length | 74 | |||||
| SBP Sequence |
>Affibody anti-CD69 Z(CD69:10)
MGSSHHHHHHYYLEVDNKFNKEFSMAMKEILALPNLNQYQKEAFKTSLKDDPSQSANLLA EAKKLNDAQAPKVD |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS004 | [1] | ||||
| Scaffold Name | Affibody | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Three Alpha-Helices | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Early activation antigen CD69 | binder | Tools for imaging of activated immune cells | Kd: 29 nM | KTH Royal Institute of Technology | [1] | |