Details of the BTS
General Information of Binding Target of SBP (BTS) (ID: ST00585) | ||||||
---|---|---|---|---|---|---|
BTS Name |
Early activation antigen CD69
|
|||||
Synonyms |
Activation inducer molecule (AIM); BL-AC/P26; C-type lectin domain family 2 member C; EA1; Early T-cell activation antigen p60; GP32/28; Leukocyte surface antigen Leu-23; MLR-3; CD Antigen CD69
|
|||||
BTS Type |
Protein
|
|||||
Gene Name |
CD69
|
|||||
Organism |
Homo sapiens (Human)
|
|||||
Function |
Transmembrane protein expressed mainly on T-cells resident in mucosa that plays an essential role in immune cell homeostasis. Rapidly expressed on the surface of platelets, T-lymphocytes and NK cells upon activation by various stimuli, such as antigen recognition or cytokine signaling, stimulates different signaling pathways in different cell types.; Negatively regulates Th17 cell differentiation through its carbohydrate dependent interaction with galectin-1/LGALS1 present on immature dendritic cells.; Association of CD69 cytoplasmic tail with the JAK3/STAT5 signaling pathway regulates the transcription of RORgamma/RORC and, consequently, differentiation toward the Th17 lineage (By similarity).; Acts also via the S100A8/S100A9 complex present on peripheral blood mononuclear cells to promote the conversion of naive CD4 T-cells into regulatory T-cells.; Acts as an oxidized low-density lipoprotein (oxLDL) receptor in CD4 T-lymphocytes and negatively regulates the inflammatory response by inducing the expression of PDCD1 through the activation of NFAT.; Participates in adipose tissue-derived mesenchymal stem cells (ASCs)-mediated protection against P. aeruginosa infection. Mechanistically, specifically recognizes P. aeruginosa to promote ERK1 activation, followed by granulocyte-macrophage colony-stimulating factor (GM-CSF) and other inflammatory cytokines secretion.; In eosinophils, induces IL-10 production through the ERK1/2 pathway (By similarity).; Negatively regulates the chemotactic responses of effector lymphocytes and dendritic cells (DCs) to sphingosine 1 phosphate/S1P by acting as a S1PR1 receptor agonist and facilitating the internalization and degradation of the recepto.
|
|||||
UniProt ID | ||||||
UniProt Entry | ||||||
PFam | ||||||
Gene ID | ||||||
Sequence |
MSSENCFVAENSSLHPESGQENDATSPHFSTRHEGSFQVPVLCAVMNVVFITILIIALIA
LSVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATL AVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTE VSSMECEKNLYWICNKPYK |
|||||
Sequence Length |
199
|
|||||
Synthetic Binding Protein (SBP) Targeting This BTS |
---|
SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
---|---|---|---|---|---|---|
Affibody anti-CD69 Z(CD69:10) | Research | binder | Kd: 29 nM | Tools for imaging of activated immune cells | [1] | |
Affibody anti-CD69 Z(CD69:12) | Research | binder | Kd: 30 nM | Tools for imaging of activated immune cells | [1] | |
Affibody anti-CD69 Z(CD69:2) | Research | binder | Kd: 52 nM | Tools for imaging of activated immune cells | [1] | |
Affibody anti-CD69 Z(CD69:4) | Research | binder | Kd: 34 nM | Tools for imaging of activated immune cells | [1] | |
Affibody anti-CD69 Z(CD69:6) | Research | binder | Kd: 51 nM | Tools for imaging of activated immune cells | [1] | |
Affibody anti-CD69 Z(CD69:8) | Research | binder | Kd: 49 nM | Tools for imaging of activated immune cells | [1] | |