General Information of Binding Target of SBP (BTS) (ID: ST00585)
BTS Name
Early activation antigen CD69
Synonyms
Activation inducer molecule (AIM); BL-AC/P26; C-type lectin domain family 2 member C; EA1; Early T-cell activation antigen p60; GP32/28; Leukocyte surface antigen Leu-23; MLR-3; CD Antigen CD69
BTS Type
Protein
Gene Name
CD69
Organism
Homo sapiens (Human)
Function
Transmembrane protein expressed mainly on T-cells resident in mucosa that plays an essential role in immune cell homeostasis. Rapidly expressed on the surface of platelets, T-lymphocytes and NK cells upon activation by various stimuli, such as antigen recognition or cytokine signaling, stimulates different signaling pathways in different cell types.; Negatively regulates Th17 cell differentiation through its carbohydrate dependent interaction with galectin-1/LGALS1 present on immature dendritic cells.; Association of CD69 cytoplasmic tail with the JAK3/STAT5 signaling pathway regulates the transcription of RORgamma/RORC and, consequently, differentiation toward the Th17 lineage (By similarity).; Acts also via the S100A8/S100A9 complex present on peripheral blood mononuclear cells to promote the conversion of naive CD4 T-cells into regulatory T-cells.; Acts as an oxidized low-density lipoprotein (oxLDL) receptor in CD4 T-lymphocytes and negatively regulates the inflammatory response by inducing the expression of PDCD1 through the activation of NFAT.; Participates in adipose tissue-derived mesenchymal stem cells (ASCs)-mediated protection against P. aeruginosa infection. Mechanistically, specifically recognizes P. aeruginosa to promote ERK1 activation, followed by granulocyte-macrophage colony-stimulating factor (GM-CSF) and other inflammatory cytokines secretion.; In eosinophils, induces IL-10 production through the ERK1/2 pathway (By similarity).; Negatively regulates the chemotactic responses of effector lymphocytes and dendritic cells (DCs) to sphingosine 1 phosphate/S1P by acting as a S1PR1 receptor agonist and facilitating the internalization and degradation of the recepto.
UniProt ID
Q07108
UniProt Entry
CD69_HUMAN
PFam
PF00059
Gene ID
969
Sequence
MSSENCFVAENSSLHPESGQENDATSPHFSTRHEGSFQVPVLCAVMNVVFITILIIALIA
LSVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATL
AVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTE
VSSMECEKNLYWICNKPYK
Sequence Length
199
Synthetic Binding Protein (SBP) Targeting This BTS
SBP Name Highest Status Mechanism Affinity Application Details Ref
Affibody anti-CD69 Z(CD69:10) Research binder Kd: 29 nM Tools for imaging of activated immune cells
SBP Info
[1]
Affibody anti-CD69 Z(CD69:12) Research binder Kd: 30 nM Tools for imaging of activated immune cells
SBP Info
[1]
Affibody anti-CD69 Z(CD69:2) Research binder Kd: 52 nM Tools for imaging of activated immune cells
SBP Info
[1]
Affibody anti-CD69 Z(CD69:4) Research binder Kd: 34 nM Tools for imaging of activated immune cells
SBP Info
[1]
Affibody anti-CD69 Z(CD69:6) Research binder Kd: 51 nM Tools for imaging of activated immune cells
SBP Info
[1]
Affibody anti-CD69 Z(CD69:8) Research binder Kd: 49 nM Tools for imaging of activated immune cells
SBP Info
[1]
References
1 Discovery, optimization and biodistribution of an Affibody molecule for imaging of CD69. Sci Rep. 2021 Sep 27;11(1):19151.