Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP003556) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Affibody anti-CD69 Z(CD69:4)
|
|||||
Synonyms |
Affibody Z(CD69:4)
|
|||||
Molecular Weight | 8.7 kDa | |||||
Thermal Denaturation TEMP | 59 ℃ | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli BL21 (DE3) | |||||
Selection Method | Escherichia coli display | |||||
Highest Status | Research | |||||
Sequence Length | 74 | |||||
SBP Sequence |
>Affibody anti-CD69 Z(CD69:4)
MGSSHHHHHHYYLEVDNKFNKEFYNAWWEIRKLPNLNAWQKEAFKTSLKDDPSQSANLLA EAKKLNDAQAPKVD |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS004 | [1] | ||||
Scaffold Name | Affibody | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Three Alpha-Helices | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Early activation antigen CD69 | binder | Tools for imaging of activated immune cells | Kd: 34 nM | KTH Royal Institute of Technology | [1] | |
Early activation antigen CD69 | binder | Tools for imaging of activated immune cells | Kd: 34 nM | KTH Royal Institute of Technology | [1] | |