General Information of Synthetic Binding Protein (SBP) (ID: SBP003556)
SBP Name
Affibody anti-CD69 Z(CD69:4)
Synonyms
Affibody Z(CD69:4)
Molecular Weight 8.7 kDa
Thermal Denaturation TEMP 59 ℃
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli BL21 (DE3)
Selection Method Escherichia coli display
Highest Status Research
Sequence Length 74
SBP Sequence
>Affibody anti-CD69 Z(CD69:4)
MGSSHHHHHHYYLEVDNKFNKEFYNAWWEIRKLPNLNAWQKEAFKTSLKDDPSQSANLLA
EAKKLNDAQAPKVD
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Protein Scaffold Information of This SBP
Scaffold ID PS004
Scaffold Info
[1]
Scaffold Name Affibody
Scaffold Class Non-Antibody
Fold Type Three Alpha-Helices
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Early activation antigen CD69
BTS Info
binder Tools for imaging of activated immune cells Kd: 34 nM KTH Royal Institute of Technology [1]
Early activation antigen CD69
BTS Info
binder Tools for imaging of activated immune cells Kd: 34 nM KTH Royal Institute of Technology [1]
References
1 Discovery, optimization and biodistribution of an Affibody molecule for imaging of CD69. Sci Rep. 2021 Sep 27;11(1):19151.