Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003540) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
vNAR anti-SARS-CoV-2 JM-17
|
|||||
| Synonyms |
vNAR JM-17
|
|||||
| Molecular Weight | 12.4 kDa | |||||
| Thermal Denaturation TEMP | 55.6 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | HEK293F cells | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 112 | |||||
| SBP Sequence |
>vNAR anti-SARS-CoV-2 JM-17
TQRVEQTPTTTTKEAGESLTINCVLRDSSCALDSTYWYFTKKGATKKESLSNGGRYAETV NKASKSFSLRISDLRVEDSGTYHCKGQLNEGCYGSWNRNYYEGGGTILTVKP |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS065 | [1] | ||||
| Scaffold Name | vNAR | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Spike glycoprotein | Binder | COVID-19 [ICD-11: RA01.0] | Kd: 2720 nM | Jimei University | [1] | |