Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP003538) | ||||||
---|---|---|---|---|---|---|
SBP Name |
vNAR anti-SARS-CoV-2 JM-2
|
|||||
Synonyms |
vNAR JM-2
|
|||||
Molecular Weight | 12.3 kDa | |||||
Thermal Denaturation TEMP | 54.9 ℃ | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | HEK293F cells | |||||
Selection Method | Phage display | |||||
Highest Status | Research | |||||
Sequence Length | 114 | |||||
SBP Sequence |
>vNAR anti-SARS-CoV-2 JM-2
TQRVEQTPTTTTKEAGESLTINCVLKGSSCALGSTYWYFTKKGATKKASLSTGGRYSDTK NTASKSFSLRISDLRVEDSGTYHCEAYETAGPDCSYSWGYSYIEGGGTILTVKP |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS065 | [1] | ||||
Scaffold Name | vNAR | |||||
Scaffold Class | Antibody fragment | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Spike glycoprotein | Binder | COVID-19 [ICD-11: RA01.0] | Kd: 429 nM | Jimei University | [1] | |