Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP003529)
SBP Name
Monobody anti-HRAS/NRAS/KRAS R15
Synonyms
Monobody R15
Molecular Weight 10.1 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Selection Method phage display; yeast display
Highest Status Research
Sequence Length 92
SBP Sequence
>Monobody anti-HRAS/NRAS/KRAS R15
VSSVPTKLEVVAATPTSLLISWDASSSSVSYYRITYGETGGNSPVQEFTVPGYYSTATIS
GLKPGVDYTITVYAYWYGYWSYISPISINYRT
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Protein Scaffold Information of This SBP
Scaffold ID PS047
Scaffold Info
[1]
Scaffold Name Monobody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
GTPase NRas
BTS Info
Inhibitor Tools for inhibition of selected oncogenic RAS mutants Kd: 219 nM Medical University of South Carolina [1]
GTPase KRas
BTS Info
Inhibitor Tools for inhibition of selected oncogenic RAS mutants Kd: 422 nM Medical University of South Carolina [1]
GTPase HRas
BTS Info
Inhibitor Tools for inhibition of selected oncogenic RAS mutants Kd: 253 nM Medical University of South Carolina [1]
References
1 Identification of the nucleotide-free state as a therapeutic vulnerability for inhibition of selected oncogenic RAS mutants. Cell Rep. 2022 Feb 8;38(6):110322.