Details of the SBP | SYNBIP

General Information of Synthetic Binding Protein (SBP) (ID: SBP003528)
SBP Name	Monobody anti-HRAS/NRAS/KRAS JAM20
Synonyms	Monobody JAM20
Molecular Weight	10.7 kDa
Design Method	Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System	Escherichia coli BL21 (DE3)
Selection Method	yeast display
Highest Status	Research
Sequence Length	96
SBP Sequence	>Monobody anti-HRAS/NRAS/KRAS JAM20 VSSVPTKLEVVAATPTSLLISWDASSSSVSYYRITYGETGGNSPVQEFTVPSYYSTATIS GLKPGVDYTITVYAYYWYGSPYYYWKASPISINYRT
3D Structure
	Computationally Modelled Structure
	Click to Save PDB File

Protein Scaffold Information of This SBP
Scaffold ID	PS047 Scaffold Info					[1]
Scaffold Name	Monobody
Scaffold Class	Non-Antibody
Fold Type	Beta-Sheets + Loops

Binding Target(s) of This SBP (BTS)

BTS Name	Details	Mechanism	Application	Affinity	Research Organization	Ref
GTPase NRas	BTS Info	Inhibitor	Tumors [ICD-11: XH1N44]	Kd: 5 nM	New York University Langone Health	[1]
GTPase NRas	BTS Info	Inhibitor	Tumors [ICD-11: XH1N44]	Kd: 21 nM	New York University Langone Health	[1]
GTPase KRas	BTS Info	Inhibitor	Tumors [ICD-11: XH1N44]	Kd: 7 nM	New York University Langone Health	[1]
GTPase KRas	BTS Info	Inhibitor	Tumors [ICD-11: XH1N44]	Kd: 28 nM	New York University Langone Health	[1]
GTPase HRas	BTS Info	Inhibitor	Tumors [ICD-11: XH1N44]	Kd: 8 nM	New York University Langone Health	[1]
GTPase HRas	BTS Info	Inhibitor	Tumors [ICD-11: XH1N44]	Kd: 16 nM	New York University Langone Health	[1]

References

1

Inhibition of RAS-driven signaling and tumorigenesis with a pan-RAS monobody targeting the Switch I/II pocket. Proc Natl Acad Sci U S A. 2022 Oct 25;119(43):e2204481119.