Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003520) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Knottin anti-nAChR Ms11a-1
|
|||||
| Synonyms |
Knottin Ms11a-1
|
|||||
| Molecular Weight | 7.6 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli BL21 (DE3) | |||||
| Highest Status | Research | |||||
| Sequence Length | 67 | |||||
| SBP Sequence |
>Knottin anti-nAChR Ms11a-1
MASKIFFFVLAVFLVMSAVLPESFAGCKKLNSNCSRQYRECCHGLVCRRPNYGNGRGILW RCVKAKK |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS042 | [1] | ||||
| Scaffold Name | Knottin | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Acetylcholine receptor, alpha-1-beta-1-gamma-deltanAChRs | Inhibitor | Tools for binding to distinct subtypes of nAChRs as well as to inhibit their function | IC50: 408 nM | Russian Academy of Sciences | [1] | |
| Neuronal acetylcholine receptor subunit alpha-7 | Inhibitor | Tools for binding to distinct subtypes of nAChRs as well as to inhibit their function | IC50: 14160 nM | Russian Academy of Sciences | [1] | |