Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003428) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
CI2-based binder anti-Subtilisin-BPN R67A mutant
|
|||||
| Synonyms |
CI2-based binder R67A mutant
|
|||||
| Molecular Weight | 7.2 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Highest Status | Research | |||||
| PDB ID | 1Y3D | |||||
| Sequence Length | 64 | |||||
| SBP Sequence |
>CI2-based binder anti-Subtilisin-BPN R67A mutant
MKTEWPELVGKSVEEAKKVILQDKPAAQIIVLPVGTIVTMEYRIDRVALFVDRLDNIAQV PRVG |
|||||
| 3D Structure | ||||||
| Experimentally Validated Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | CI2 | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS022 | [1] | ||||
| Scaffold Name | CI2-based binder | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | One Alpha-Helix + Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Subtilisin BPN' | Inhibitor | Research tool | Kd: 0.56 nM | University of California | [1] | |