Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP003425) | ||||||
---|---|---|---|---|---|---|
SBP Name |
CI2-based binder anti-Subtilisin-BPN M59R/E60S mutant
|
|||||
Synonyms |
CI2-based binder M59R/E60S mutant
|
|||||
Molecular Weight | 7.3 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli | |||||
Highest Status | Research | |||||
PDB ID | 1Y4A; 1Y4D | |||||
Sequence Length | 64 | |||||
SBP Sequence |
>CI2-based binder anti-Subtilisin-BPN M59R/E60S mutant
MKTEWPELVGKSVEEAKKVILQDKPAAQIIVLPVGTIVTRSYRIDRVRLFVDRLDNIAQV PRVG |
|||||
3D Structure | ||||||
Experimentally Validated Structure | ||||||
Click to Save PDB File | ||||||
Template Name | CI2 | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS022 | [1] | ||||
Scaffold Name | CI2-based binder | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | One Alpha-Helix + Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Subtilisin BPN' | Inhibitor | Research tool | Kd: 1.2 nM | University of California | [1] | |