General Information of Synthetic Binding Protein (SBP) (ID: SBP003412)
SBP Name
DARPin anti-BPP clone 18
Synonyms
DARPin 18
Molecular Weight 13.5 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli XL1-Blue
Selection Method Ribosome display
Highest Status Research
Sequence Length 126
SBP Sequence
>DARPin anti-BPP clone 18
GSDLGKKLLEAARVGHDDEVRILMANGADVNASDWVGLTPLHLAAMIGHLEIVEVLLKHG
TDVNAKDFNGETPLHLAAVYGHLEIVEVLLKHGADVNAQDKFGKTAFDISIDNGNEDLAE
ILQKLN
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Protein Scaffold Information of This SBP
Scaffold ID PS027
Scaffold Info
[1]
Scaffold Name DARPin
Scaffold Class Non-Antibody
Fold Type Alpha-Helices + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
BPP
BTS Info
Inhibitor Lactococcus lactis infection Kd: 7.5 nM Aix-Marseille University [1]
References
1 Crystal structure and function of a DARPin neutralizing inhibitor of lactococcal phage TP901-1: comparison of DARPin and camelid VHH binding mode. J Biol Chem. 2009 Oct 30;284(44):30718-26.