Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP003407) | ||||||
---|---|---|---|---|---|---|
SBP Name |
I-body anti-CXCR4 AM4-1121
|
|||||
Synonyms |
I-body AM4-1121
|
|||||
Molecular Weight | 11.5 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Human embryonic kidney?cells 293 | |||||
Selection Method | Surface plasmon resonance | |||||
Highest Status | Research | |||||
Sequence Length | 103 | |||||
SBP Sequence |
>I-body anti-CXCR4 AM4-1121
LQVDIVPSQGEISVGESKFFLCQVAGSKSGIRISWFSPNGEKLTPNQQRISVVWNDDSSS TLTIYNANIDDAGIYKCVVYRTGGYRHRYLRLGEATVNVKIFQ |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | Neural cell adhesion molecule (NCAM) | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS040 | [1] | ||||
Scaffold Name | I-body | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
C-X-C chemokine receptor type 4 | Antagonist | Cancers [ICD-11: 2D4Z]; Fibrosis [ICD-11: CA25.Z] | Kd: 6.3 nM | AdAlta | [1] | |