Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003406) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
I-body anti-CXCR4 AM4-746
|
|||||
| Synonyms |
I-body AM4-746
|
|||||
| Molecular Weight | 11.5 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Human embryonic kidney?cells 293 | |||||
| Selection Method | Surface plasmon resonance | |||||
| Highest Status | Research | |||||
| Sequence Length | 103 | |||||
| SBP Sequence |
>I-body anti-CXCR4 AM4-746
LQVDIVPSQGEISVGESKFFLCQVAGSKSNIRISWFSPNGEKLTPNQQRISVVWNDDSSS TLTIYNANIDDAGIYKCVVYRTGGYRHRYLKLGEATVNVKIFQ |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Neural cell adhesion molecule (NCAM) | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS040 | [1] | ||||
| Scaffold Name | I-body | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| C-X-C chemokine receptor type 4 | Antagonist | Cancers [ICD-11: 2D4Z]; Fibrosis [ICD-11: CA25.Z] | Kd: 4.0 nM | AdAlta | [1] | |