Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP003042)
SBP Name
DARPin anti-CD4 clone 1.1
Synonyms
DARPin 1.1
Molecular Weight 13.5 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Ribosome display
Highest Status Research
Sequence Length 126
SBP Sequence
>DARPin anti-CD4 clone 1.1
GSDLGKKLLEAARAGQDDEVRILMANGADVNARDWIGLTPLHLAALYGHLEIVEVLLKHG
ADVNANDFDGETPLHLAALLGHLEIVEVLLKNGADVNAQDKFGKTAFDISIDNGNEDLAE
ILHKLN
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name AR module
Protein Scaffold Information of This SBP
Scaffold ID PS027
Scaffold Info
[1] , [2]
Scaffold Name DARPin
Scaffold Class Non-Antibody
Fold Type Alpha-Helices + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
T-cell surface glycoprotein CD4
BTS Info
Inhibitor Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z] N.A. Paul-Ehrlich-Institut [1] , [2]
References
1 Designed Ankyrin Repeat Protein (DARPin) to target chimeric antigen receptor (CAR)-redirected T cells towards CD4 + T cells to reduce the latent HIV + cell reservoir. Med Microbiol Immunol. 2020 Dec;209(6):681-691.
2 CD4-specific designed ankyrin repeat proteins are novel potent HIV entry inhibitors with unique characteristics. PLoS Pathog. 2008 Jul 25;4(7):e1000109.