General Information of Binding Target of SBP (BTS) (ID: ST00128)
BTS Name
T-cell surface glycoprotein CD4
Synonyms
T-cell surface antigen T4/Leu-3; CD antigen CD4
BTS Type
Protein
Gene Name
CD4
Organism
Homo sapiens (Human)
Function
Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class II molecule:peptide complex. The antigens presented by class II peptides are derived from extracellular proteins while class I peptides are derived from cytosolic proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class II presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK then initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of T-helper cells. In other cells such as macrophages or NK cells, plays a role in differentiation/activation, cytokine expression and cell migration in a TCR/LCK-independent pathway. Participates in the development of T-helper cells in the thymus and triggers the differentiation of monocytes into functional mature macrophages.; (Microbial infection) Primary receptor for human immunodeficiency virus-1 (HIV-1) Down-regulated by HIV-1 Vpu Acts as a receptor for Human Herpes virus 7/HHV-7
UniProt ID
P01730
UniProt Entry
CD4_HUMAN
PFam
PF05790 ; PF09191 ; PF00047 ; PF12104
Gene ID
920
Sequence
MNRGVPFRHLLLVLQLALLPAATQGKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIK
ILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQL
LVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSG
TWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWW
QAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLA
LEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWV
LNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCV
RCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI
Sequence Length
458
Synthetic Binding Protein (SBP) Targeting This BTS
SBP Name Highest Status Mechanism Affinity Application Details Ref
DARPin anti-CD4 clone 1.1 Research Inhibitor N.A. Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z]
SBP Info
[1], [2]
DARPin anti-CD4 clone 2.1 Research Inhibitor N.A. Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z]
SBP Info
[1], [2]
DARPin anti-CD4 clone 23.2 Research Inhibitor Kd: 0.26 nM Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z]
SBP Info
[1], [2]
DARPin anti-CD4 clone 25.2 Research Inhibitor N.A. Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z]
SBP Info
[1], [2]
DARPin anti-CD4 clone 27.2 Research Inhibitor Kd: 1.8 nM Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z]
SBP Info
[1], [2]
DARPin anti-CD4 clone 29.2 Research Inhibitor Kd: 1.5 nM Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z]
SBP Info
[1], [2]
DARPin anti-CD4 clone 3.1 Research Inhibitor Kd: 8.9 nM Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z]
SBP Info
[1], [2]
DARPin anti-CD4 clone 4.1 Research Inhibitor N.A. Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z]
SBP Info
[1], [2]
DARPin anti-CD4 clone 5.1 Research Inhibitor N.A. Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z]
SBP Info
[1], [2]
DARPin anti-CD4 clone 55.2 Research Inhibitor Kd: 0.84 nM Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z]
SBP Info
[1], [2]
DARPin anti-CD4 clone 57.2 Research Inhibitor Kd: 1.8 nM Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z]
SBP Info
[1], [2]
DARPin anti-CD4 clone 6.1 Research Inhibitor N.A. Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z]
SBP Info
[1], [2]
Diabody anti-CD4 GK1.5 Research Inhibitor Kd: 2.7 nM ImmunoPET imaging of murine CD4+ T cells
SBP Info
[3]
References
1 Designed Ankyrin Repeat Protein (DARPin) to target chimeric antigen receptor (CAR)-redirected T cells towards CD4 + T cells to reduce the latent HIV + cell reservoir. Med Microbiol Immunol. 2020 Dec;209(6):681-691.
2 CD4-specific designed ankyrin repeat proteins are novel potent HIV entry inhibitors with unique characteristics. PLoS Pathog. 2008 Jul 25;4(7):e1000109.
3 ImmunoPET Imaging of Murine CD4 + T Cells Using Anti-CD4 Cys-Diabody: Effects of Protein Dose on T Cell Function and Imaging. Mol Imaging Biol. 2017 Aug;19(4):599-609.