Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00128) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
T-cell surface glycoprotein CD4
|
|||||
| Synonyms |
T-cell surface antigen T4/Leu-3; CD antigen CD4
|
|||||
| BTS Type |
Protein
|
|||||
| Gene Name |
CD4
|
|||||
| Organism |
Homo sapiens (Human)
|
|||||
| Function |
Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class II molecule:peptide complex. The antigens presented by class II peptides are derived from extracellular proteins while class I peptides are derived from cytosolic proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class II presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK then initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of T-helper cells. In other cells such as macrophages or NK cells, plays a role in differentiation/activation, cytokine expression and cell migration in a TCR/LCK-independent pathway. Participates in the development of T-helper cells in the thymus and triggers the differentiation of monocytes into functional mature macrophages.; (Microbial infection) Primary receptor for human immunodeficiency virus-1 (HIV-1) Down-regulated by HIV-1 Vpu Acts as a receptor for Human Herpes virus 7/HHV-7
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Gene ID | ||||||
| Sequence |
MNRGVPFRHLLLVLQLALLPAATQGKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIK
ILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQL LVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSG TWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWW QAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLA LEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWV LNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCV RCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI |
|||||
| Sequence Length |
458
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| DARPin anti-CD4 clone 1.1 | Research | Inhibitor | N.A. | Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z] | [1], [2] | |
| DARPin anti-CD4 clone 2.1 | Research | Inhibitor | N.A. | Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z] | [1], [2] | |
| DARPin anti-CD4 clone 23.2 | Research | Inhibitor | Kd: 0.26 nM | Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z] | [1], [2] | |
| DARPin anti-CD4 clone 25.2 | Research | Inhibitor | N.A. | Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z] | [1], [2] | |
| DARPin anti-CD4 clone 27.2 | Research | Inhibitor | Kd: 1.8 nM | Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z] | [1], [2] | |
| DARPin anti-CD4 clone 29.2 | Research | Inhibitor | Kd: 1.5 nM | Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z] | [1], [2] | |
| DARPin anti-CD4 clone 3.1 | Research | Inhibitor | Kd: 8.9 nM | Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z] | [1], [2] | |
| DARPin anti-CD4 clone 4.1 | Research | Inhibitor | N.A. | Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z] | [1], [2] | |
| DARPin anti-CD4 clone 5.1 | Research | Inhibitor | N.A. | Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z] | [1], [2] | |
| DARPin anti-CD4 clone 55.2 | Research | Inhibitor | Kd: 0.84 nM | Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z] | [1], [2] | |
| DARPin anti-CD4 clone 57.2 | Research | Inhibitor | Kd: 1.8 nM | Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z] | [1], [2] | |
| DARPin anti-CD4 clone 6.1 | Research | Inhibitor | N.A. | Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z] | [1], [2] | |
| Diabody anti-CD4 GK1.5 | Research | Inhibitor | Kd: 2.7 nM | ImmunoPET imaging of murine CD4+ T cells | [3] | |
| References |
|---|