Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP001883) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Fynomer anti-Chymase 3C-D7
|
|||||
| Synonyms |
Fynomer 3C-D7
|
|||||
| Molecular Weight | 7.2 kDa | |||||
| Thermal Denaturation TEMP | 70 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli TG1 | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 63 | |||||
| SBP Sequence |
>Fynomer anti-Chymase 3C-D7
GVTLFVALYDYQADRWTDLSFHKGEKFQILSFHVGDWWEARSLTTGETGYIPSNYVAPVD SIQ |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Fyn SH3 | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS035 | [1] | ||||
| Scaffold Name | Fynomer | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Chymase | Inhibitor | Research tool | Kd: 15.4 nM | F. Hoffmann-La Roche Ltd | [1] | |