Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP001494) | ||||||
---|---|---|---|---|---|---|
SBP Name |
DARPin anti-IL-4 clone 44
|
|||||
Synonyms |
DARPin 44
|
|||||
Molecular Weight | 16.6 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli BL21 (DE3) | |||||
Highest Status | Research | |||||
PDB ID | 4YDW | |||||
Sequence Length | 159 | |||||
SBP Sequence |
>DARPin anti-IL-4 clone 44
GSDLGKKLLEAARAGQDDEVRILMANGADVNALDDSGYTPLHLAAEDGHLEIVEVLLKHG ADVNAADRLGDTPLHLAAFVGHLEIVEVLLKAGADVNAVDLAGVTPLHVAAFYGHLEIVE VLLKAGADVNAQDKFGKTPADIAADNGHEDIAEVLQKLN |
|||||
3D Structure |
|
|||||
Experimentally Validated Structure | ||||||
Click to Save PDB File | ||||||
Template Name | AR module | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS027 | [1] | ||||
Scaffold Name | DARPin | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Alpha-Helices + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Interleukin-4 | Binder | Tools for inducing conformational change in human IL-4 upon | Kd: 0.013-0.021 nM | Janssen Research & Development, L.L.C. | [1] | |