General Information of Synthetic Binding Protein (SBP) (ID: SBP001416)
SBP Name
DARPin anti-GluA4 SD7
Synonyms
DARPin SD7
Molecular Weight 16.9 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Ribosome display
Highest Status Research
Sequence Length 163
SBP Sequence
>DARPin anti-GluA4 SD7
AAQPAKDLGKKLLDAASAGQDDEVRILMANGADVNASDWRGRTPLHAAAQKGHLEIVDVL
LAHGADVNASDTNGSTPLHAAASSGHLEIVDVLLANGADVNASNHYGWTPLHTAASYGHL
EIVDVLLAYGADVNANTYSGKTPFDLAIDNGNEDIAEVLQKAA
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name S-N3C
Protein Scaffold Information of This SBP
Scaffold ID PS027
Scaffold Info
[1]
Scaffold Name DARPin
Scaffold Class Non-Antibody
Fold Type Alpha-Helices + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Glutamate receptor 4
BTS Info
Binder Tools as Ligands for Receptor-Targeted AAV and Lentiviral Vectors N.A. Paul-Ehrlich-Institut [1]
References
1 A Library-Based Screening Strategy for the Identification of DARPins as Ligands for Receptor-Targeted AAV and Lentiviral Vectors. Mol Ther Methods Clin Dev. 2018 Jul 6;10:128-143.