Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00117) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
Glutamate receptor 4
|
|||||
| Synonyms |
GluR-4; GluR4; AMPA-selective glutamate receptor 4; GluR-D; Glutamate receptor ionotropic, AMPA 4; GluA4
|
|||||
| BTS Type |
Protein
|
|||||
| Family |
Glutamate-gated ion channel (TC 1.A.10.1) family;
GRIA4 subfamily |
|||||
| Gene Name |
Gria4
|
|||||
| Organism |
Mus musculus (Mouse)
|
|||||
| Function |
Receptor for glutamate that functions as ligand-gated ion channel in the central nervous system and plays an important role in excitatory synaptic transmission. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. In the presence of CACNG4 or CACNG7 or CACNG8, shows resensitization which is characterized by a delayed accumulation of current flux upon continued application of glutamate (By similarity).
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Gene ID | ||||||
| Sequence |
MRIICRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWH VSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIA NLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSAL TYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGN VQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDAPTLGNDTAAIENRTVVVT TIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTK IWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL DPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLW FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED LAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKG KFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGV LDKLKNKWWYDKGECGPKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKS RAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHTGTAIRQSSGLAVIASD LP |
|||||
| Sequence Length |
902
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| DARPin anti-GluA4 2A10 | Research | Binder | N.A. | Tools as Ligands for Receptor-Targeted AAV and Lentiviral Vectors | [1] | |
| DARPin anti-GluA4 2A2 | Research | Binder | N.A. | Tools as Ligands for Receptor-Targeted AAV and Lentiviral Vectors | [1] | |
| DARPin anti-GluA4 2B7 | Research | Binder | Kd: 8.4 nM | Tools as Ligands for Receptor-Targeted AAV and Lentiviral Vectors | [1] | |
| DARPin anti-GluA4 2G10 | Research | Binder | N.A. | Tools as Ligands for Receptor-Targeted AAV and Lentiviral Vectors | [1] | |
| DARPin anti-GluA4 2K19 | Research | Binder | Kd: 1.6-3.7 nM | Tools as Ligands for Receptor-Targeted AAV and Lentiviral Vectors | [1] | |
| DARPin anti-GluA4 SA8 | Research | Binder | N.A. | Tools as Ligands for Receptor-Targeted AAV and Lentiviral Vectors | [1] | |
| DARPin anti-GluA4 SB4 | Research | Binder | Kd: 19 nM | Tools as Ligands for Receptor-Targeted AAV and Lentiviral Vectors | [1] | |
| DARPin anti-GluA4 SC5 | Research | Binder | N.A. | Tools as Ligands for Receptor-Targeted AAV and Lentiviral Vectors | [1] | |
| DARPin anti-GluA4 SD6 | Research | Binder | N.A. | Tools as Ligands for Receptor-Targeted AAV and Lentiviral Vectors | [1] | |
| DARPin anti-GluA4 SD7 | Research | Binder | N.A. | Tools as Ligands for Receptor-Targeted AAV and Lentiviral Vectors | [1] | |
| DARPin anti-GluA4 SD8 | Research | Binder | Kd: 1.6-3.7 nM | Tools as Ligands for Receptor-Targeted AAV and Lentiviral Vectors | [1] | |
| DARPin anti-GluA4/GluA2 SK14 | Research | Binder | Kd: 1.6-3.7 nM | Tools as Ligands for Receptor-Targeted AAV and Lentiviral Vectors | [1] | |