Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP001399) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Centyrin anti-leukocidins SM1S26
|
|||||
Synonyms |
Centyrin SM1S26
|
|||||
Molecular Weight | 9.8 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli | |||||
Selection Method | CIS display | |||||
Highest Status | Research | |||||
Sequence Length | 92 | |||||
SBP Sequence |
>Centyrin anti-leukocidins SM1S26
MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFHIEYAEPWVWGEAIVLTVPGSERSYDLT GLKPGTEYVVFIGGVKGGHNSTPLSAIFTTGGHHHHHH |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | Tencon | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS020 | [1] | ||||
Scaffold Name | Centyrin | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Leukocidin | Inhibitor | Staphylococcus aureus [ICD-11: XN6BM] | Kd: 11.3 nM | New York University School | [1] | |