General Information of Synthetic Binding Protein (SBP) (ID: SBP001399)
SBP Name
Centyrin anti-leukocidins SM1S26
Synonyms
Centyrin SM1S26
Molecular Weight 9.8 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method CIS display
Highest Status Research
Sequence Length 92
SBP Sequence
>Centyrin anti-leukocidins SM1S26
MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFHIEYAEPWVWGEAIVLTVPGSERSYDLT
GLKPGTEYVVFIGGVKGGHNSTPLSAIFTTGGHHHHHH
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Tencon
Protein Scaffold Information of This SBP
Scaffold ID PS020
Scaffold Info
[1]
Scaffold Name Centyrin
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Leukocidin
BTS Info
Inhibitor Staphylococcus aureus [ICD-11: XN6BM] Kd: 11.3 nM New York University School [1]
References
1 Identification of biologic agents to neutralize the bicomponent leukocidins of Staphylococcus aureus. Sci Transl Med. 2019 Jan 16;11(475):eaat0882.