Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP001395) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Centyrin anti-Leukocidin/Toxin-HlgA SM1S449
|
|||||
| Synonyms |
Centyrin SM1S449
|
|||||
| Molecular Weight | 9.8 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | CIS display | |||||
| Highest Status | Research | |||||
| Sequence Length | 92 | |||||
| SBP Sequence |
>Centyrin anti-Leukocidin/Toxin-HlgA SM1S449
MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFDISYDEYPEFGEAIVLTVPGSERSYDLT GLKPGTEYLVDIIGVKGGEISLPLSAIFTTGG |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Tencon | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS020 | [1] | ||||
| Scaffold Name | Centyrin | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Toxin HlgA | Inhibitor | Staphylococcus aureus [ICD-11: XN6BM] | Kd: 9.2 nM | New York University School | [1] | |
| Leukocidin | Inhibitor | Staphylococcus aureus [ICD-11: XN6BM] | Kd: 32.4 nM | New York University School | [1] | |