General Information of Synthetic Binding Protein (SBP) (ID: SBP001165)
SBP Name
Monobody anti-Yes-SH2/Src-SH2 clone 1
Synonyms
Monobody Yes_1
Molecular Weight 10.6 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System K562 Cells
Selection Method Phage display, Yeast display and Fluorescence-activated cell sorting
Highest Status Research
PDB ID 5MTJ
Sequence Length 96
SBP Sequence
>Monobody anti-Yes-SH2/SrS-SH2 Slone 1
VSSVPTKLEVVAATPTSLLISWDAPAVTVDYYFITYGETGGNSPVQEFTVPGSKSTATIS
GLKPGVDYTITVYAWYYYDDEYYMNESSPISINYRT
3D Structure
Experimentally Validated Structure
Click to Save PDB File
Template Name Fibronectin type III domain (FN3)
Template Sequence Description X denotes a mixture of 30% Tyr, 15% Ser, 10% Gly, 5% Phe, 5% Trp, and 2.5% each of all the other amino acids except for Cys; O denotes a mixture of Asn, Asp, His, Ile, Leu, Phe, Tyr, and Val; U denotes a mixture of His, Leu, Phe, and Tyr; Z denotes a mixture of Ala, Glu, Lys, and Thr.
Protein Scaffold Information of This SBP
Scaffold ID PS047
Scaffold Info
[1]
Scaffold Name Monobody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Src-homology 2 domain-containing phosphatase 2
BTS Info
Inhibitor Tools for dissecting SFK functions in normal development and signaling Kd: 1129 nM Swiss Institute for Experimental Cancer Research (ISREC) [1]
SrcA subgroup Yes-Src-homology 2
BTS Info
Inhibitor Tools for dissecting SFK functions in normal development and signaling Kd: 338 nM Swiss Institute for Experimental Cancer Research (ISREC) [1]
References
1 Selective Targeting of SH2 Domain-Phosphotyrosine Interactions of Src Family Tyrosine Kinases with Monobodies. J Mol Biol. 2017 May 5;429(9):1364-1380.