Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP000996)
SBP Name
VL dAb anti-MBP-intimin VL383(SS)-4
Synonyms
VL383(SS)-4
Molecular Weight 11.6 kDa
Thermal Denaturation TEMP 65.3 ℃
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli TG1
Selection Method Phage display
Highest Status Research
Sequence Length 106
SBP Sequence
>VL dAb anti-MBP-intimin VL383(SS)-4
ETTLTQSPGTLSLSPGERATLSCRASQSVVHNLAWYQKKPGQSPRLLCHGLSTRAHGVPA
RFSCGGSGTDFTLTISRLEPEDFAVYYCQQFDHPYTFGQGTKVEIK
Sequence Description Cys I and Cys II form a bridge.
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name VL383(SS)
Template Sequence Description Cys I and Cys II form a bridge.
Protein Scaffold Information of This SBP
Scaffold ID PS064
Scaffold Info
[1]
Scaffold Name VL dAb
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Intimin
BTS Info
Binder Research tool Kd: 227 nM National Research Council of Canada [1]
References
1 Stability-Diversity Tradeoffs Impose Fundamental Constraints on Selection of Synthetic Human V H/V L Single-Domain Antibodies from In Vitro Display Libraries. Front Immunol. 2017 Dec 12;8:1759.