Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000979) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Human VH dAb anti-MBP-intimin VHB82(SS)-8
|
|||||
Synonyms |
Human VH dAb VHB82(SS)-8
|
|||||
Molecular Weight | 13.4 kDa | |||||
Thermal Denaturation TEMP | 69.3 ℃ | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli TG1 | |||||
Selection Method | Phage display | |||||
Highest Status | Research | |||||
Sequence Length | 122 | |||||
SBP Sequence |
>Human VH dAb anti-MBP-intimin VHB82(SS)-8
QVQLQESGGGLVQPGGSLRLSCAASGFTFSRYPVAWVRQAPGKGLEWVCVISSTGTSTYY ADSVKGRFTCSRDNSKNTLYLQMNSLRAEDTAVYYCNSQRTRLQDPNEYDYWGKGTTVTV SS |
|||||
Sequence Description | Cys I and Cys II form a bridge. | |||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | VHB82(SS) | |||||
Template Sequence Description | Cys I and Cys II form a bridge. | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS039 | [1] | ||||
Scaffold Name | Human VH dAb | |||||
Scaffold Class | Antibody fragment | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Intimin | Binder | Research tool | Kd: 5230 nM | National Research Council of Canada | [1] | |