Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000974) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Human VH dAb anti-CEACAM6 VH428-3
|
|||||
Synonyms |
Human VH dAb 428-3
|
|||||
Molecular Weight | 12.9 kDa | |||||
Thermal Denaturation TEMP | 52.9 ℃ | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli TG1 | |||||
Selection Method | Phage display | |||||
Highest Status | Research | |||||
Sequence Length | 121 | |||||
SBP Sequence |
>Human VH dAb anti-CEACAM6 VH428-3
QLQLQESGGGLVQPGGSLRLSCAASGFTFSSYAMSWFRQAPGKGLEWVGAISGGGDHTYY AASVKGRFTISRDDSKSIAYLQMNSLRAEDTAMYYCEGMVRGVSSAPFDYWGQGTLVTVS S |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | VH428 | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS039 | [1] | ||||
Scaffold Name | Human VH dAb | |||||
Scaffold Class | Antibody fragment | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Carcinoembryonic antigen-related cell adhesion molecule 6 | Binder | Research tool | Kd: 290 nM | National Research Council of Canada | [1] | |