General Information of Synthetic Binding Protein (SBP) (ID: SBP000974)
SBP Name
Human VH dAb anti-CEACAM6 VH428-3
Synonyms
Human VH dAb 428-3
Molecular Weight 12.9 kDa
Thermal Denaturation TEMP 52.9 ℃
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli TG1
Selection Method Phage display
Highest Status Research
Sequence Length 121
SBP Sequence
>Human VH dAb anti-CEACAM6 VH428-3
QLQLQESGGGLVQPGGSLRLSCAASGFTFSSYAMSWFRQAPGKGLEWVGAISGGGDHTYY
AASVKGRFTISRDDSKSIAYLQMNSLRAEDTAMYYCEGMVRGVSSAPFDYWGQGTLVTVS
S
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name VH428
Protein Scaffold Information of This SBP
Scaffold ID PS039
Scaffold Info
[1]
Scaffold Name Human VH dAb
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Carcinoembryonic antigen-related cell adhesion molecule 6
BTS Info
Binder Research tool Kd: 290 nM National Research Council of Canada [1]
References
1 Stability-Diversity Tradeoffs Impose Fundamental Constraints on Selection of Synthetic Human V H/V L Single-Domain Antibodies from In Vitro Display Libraries. Front Immunol. 2017 Dec 12;8:1759.