Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00182) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
Carcinoembryonic antigen-related cell adhesion molecule 6
|
|||||
| Synonyms |
Non-specific crossreacting antigen; Normal cross-reacting antigen; CD antigen CD66c
|
|||||
| BTS Type |
Protein
|
|||||
| Family |
Immunoglobulin superfamily;
CEA family |
|||||
| Gene Name |
CEACAM6
|
|||||
| Organism |
Homo sapiens (Human)
|
|||||
| Function |
Cell surface glycoprotein that plays a role in cell adhesion and tumor progression Intercellular adhesion occurs in a calcium- and fibronectin-independent manner Mediates homophilic and heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM5 and CEACAM8 Heterophilic interaction with CEACAM8 occurs in activated neutrophils Plays a role in neutrophil adhesion to cytokine-activated endothelial cells Plays a role as an oncogene by promoting tumor progression; positively regulates cell migration, cell adhesion to endothelial cells and cell invasion Also involved in the metastatic cascade process by inducing gain resistance to anoikis of pancreatic adenocarcinoma and colorectal carcinoma cells
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Gene ID | ||||||
| Sequence |
MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQ
NRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFY TLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWV NGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGP TISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQ AHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI |
|||||
| Sequence Length |
344
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| Human VH dAb anti-CEACAM6 VH428-3 | Research | Binder | Kd: 290 nM | Research tool | [1] | |
| Human VH dAb anti-CEACAM6 VHB82(SS)-2 | Research | Binder | Kd: 245 nM | Research tool | [1] | |
| VL dAb anti-CEACAM6 VL383(SS)-1 | Research | Binder | Kd: 454 nM | Research tool | [1] | |