Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP000804)
SBP Name
WW domain anti-peptide mutant L30K
Synonyms
WW domain mutant L30K
Molecular Weight 6.4 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Highest Status Research
PDB ID 1JMQ
Sequence Length 57
SBP Sequence
>WW domain anti-peptide mutant L30K
GMSSFEIPDDVPLPAGWEMAKTSSGQRYFKNHIDQTTTWQDPRKAMLSQMNVTAPTS
3D Structure
Experimentally Validated Structure
Click to Save PDB File
Template Name hYAP65
Protein Scaffold Information of This SBP
Scaffold ID PS067
Scaffold Info
[1]
Scaffold Name WW domain
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
WW1 peptide
BTS Info
Binder Tools for studying peptide recognition Kd: 40000 nM Forschungsinstitut fr Molekulare Pharmakologie, Germany [1]
References
1 Solution structures of the YAP65 WW domain and the variant L30 K in complex with the peptides GTPPPPYTVG, N-(n-octyl)-GPPPY and PLPPY and the application of peptide libraries reveal a minimal binding epitope. J Mol Biol. 2001 Dec 14;314(5):1147-56.