Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000800) | ||||||
---|---|---|---|---|---|---|
SBP Name |
WW domain anti-peptide mutant PK1
|
|||||
Synonyms |
WW domain mutant PK1
|
|||||
Molecular Weight | 6.4 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli BL21 (DE3) | |||||
Selection Method | Phage display | |||||
Highest Status | Research | |||||
Sequence Length | 57 | |||||
SBP Sequence |
>WW domain anti-peptide mutant PK1
GMSSFEIPDDVPLPAGWEMAKTSSGQRGSFWFDRWTTTWQDPRKAMLSQMNVTAPTS |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | hYAP65 | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS067 | [1] | ||||
Scaffold Name | WW domain | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
WW1 peptide | Binder | Tools for studying peptide recognition | Kd: 102000 nM | University College London | [1] | |