General Information of Synthetic Binding Protein (SBP) (ID: SBP000800)
SBP Name
WW domain anti-peptide mutant PK1
Synonyms
WW domain mutant PK1
Molecular Weight 6.4 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli BL21 (DE3)
Selection Method Phage display
Highest Status Research
Sequence Length 57
SBP Sequence
>WW domain anti-peptide mutant PK1
GMSSFEIPDDVPLPAGWEMAKTSSGQRGSFWFDRWTTTWQDPRKAMLSQMNVTAPTS
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name hYAP65
Protein Scaffold Information of This SBP
Scaffold ID PS067
Scaffold Info
[1]
Scaffold Name WW domain
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
WW1 peptide
BTS Info
Binder Tools for studying peptide recognition Kd: 102000 nM University College London [1]
References
1 Evolution of binding affinity in a WW domain probed by phage display. Protein Sci. 2000 Dec;9(12):2366-76.