General Information of Synthetic Binding Protein (SBP) (ID: SBP000748)
SBP Name
Neocarzinostatin-based binder anti-Testosterone NCS-A6
Synonyms
Neocarzinostatin-based binder NCS-A6
Molecular Weight 11.3 kDa
Thermal Denaturation TEMP 52.3 ℃
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Phage display
Highest Status Research
Sequence Length 112
SBP Sequence
>Neocarzinostatin-based binder anti-Testosterone NCS-A6
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADAN
GSASTSLTVRRSFEGFLFDGTRWGTVDATRTQTQVGLSDAAGNGPEGVAISF
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name NCS-3.24
Template Sequence Description Cys I and Cys II form disulfide bonds.
Protein Scaffold Information of This SBP
Scaffold ID PS049
Scaffold Info
[1]
Scaffold Name Neocarzinostatin-based binder
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Testosterone
BTS Info
Binder Cancers [ICD-11: 2D4Z] N.A. University of Southern Paris [1]
References
1 Disulfide bond substitution by directed evolution in an engineered binding protein. Chembiochem. 2009 May 25;10(8):1349-59.