Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000748) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Neocarzinostatin-based binder anti-Testosterone NCS-A6
|
|||||
| Synonyms |
Neocarzinostatin-based binder NCS-A6
|
|||||
| Molecular Weight | 11.3 kDa | |||||
| Thermal Denaturation TEMP | 52.3 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 112 | |||||
| SBP Sequence |
>Neocarzinostatin-based binder anti-Testosterone NCS-A6
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADAN GSASTSLTVRRSFEGFLFDGTRWGTVDATRTQTQVGLSDAAGNGPEGVAISF |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | NCS-3.24 | |||||
| Template Sequence Description | Cys I and Cys II form disulfide bonds. | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS049 | [1] | ||||
| Scaffold Name | Neocarzinostatin-based binder | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Testosterone | Binder | Cancers [ICD-11: 2D4Z] | N.A. | University of Southern Paris | [1] | |