Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000748) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Neocarzinostatin-based binder anti-Testosterone NCS-A6
|
|||||
Synonyms |
Neocarzinostatin-based binder NCS-A6
|
|||||
Molecular Weight | 11.3 kDa | |||||
Thermal Denaturation TEMP | 52.3 ℃ | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli | |||||
Selection Method | Phage display | |||||
Highest Status | Research | |||||
Sequence Length | 112 | |||||
SBP Sequence |
>Neocarzinostatin-based binder anti-Testosterone NCS-A6
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADAN GSASTSLTVRRSFEGFLFDGTRWGTVDATRTQTQVGLSDAAGNGPEGVAISF |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | NCS-3.24 | |||||
Template Sequence Description | Cys I and Cys II form disulfide bonds. | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS049 | [1] | ||||
Scaffold Name | Neocarzinostatin-based binder | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Testosterone | Binder | Cancers [ICD-11: 2D4Z] | N.A. | University of Southern Paris | [1] | |