Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP000743)
SBP Name
Neocarzinostatin-based binder anti-Testosterone NCS-1a.15
Synonyms
Neocarzinostatin-based binder NCS-1a.15
Molecular Weight 11.2 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Phage display
Highest Status Research
PDB ID 2CBQ
Sequence Length 113
SBP Sequence
>Neocarzinostatin-based binder anti-Testosterone NCS-1a.15
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVYQRAAVDTGVHASNPADLSSVTADAN
GSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISFN
3D Structure
Experimentally Validated Structure
Click to Save PDB File
Template Name Neocarzinostatin
Template Sequence Description Cys I and Cys II form disulfide bonds; Cys III and Cys IV form disulfide bonds.
Protein Scaffold Information of This SBP
Scaffold ID PS049
Scaffold Info
[1] , [2]
Scaffold Name Neocarzinostatin-based binder
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Testosterone
BTS Info
Inhibitor Research tool Kd: 14800 nM University of Southern Paris [1] , [2]
References
1 Structures of in vitro evolved binding sites on neocarzinostatin scaffold reveal unanticipated evolutionary pathways. J Mol Biol. 2006 Apr 28;358(2):455-71.
2 In vitro evolution of the binding specificity of neocarzinostatin, an enediyne-binding chromoprotein. Biochemistry. 2003 May 20;42(19):5674-83.