Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP000738)
SBP Name
Tendamistat-based binder anti-mAbA8/Alpha-amylase A8-7
Synonyms
Tendamistat-based binder A8-7
Molecular Weight 8.3 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Phage display
Highest Status Research
Sequence Length 77
SBP Sequence
>Tendamistat-based binder anti-mAbA8/Alpha-amylase A8-7
DTTVSEPAPSCVTLYQSWRYSQADNGCAETVTVKVVYMYMTEGLCYAVAPGQITTVGDGF
NVTYAHARYLARCLGGS
Sequence Description Cys I and Cys II form disulfide bonds; Cys III and Cys IV form disulfide bonds.
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Tendamistat
Template Sequence Description Cys I and Cys II form disulfide bonds; Cys III and Cys IV form disulfide bonds.
Protein Scaffold Information of This SBP
Scaffold ID PS062
Scaffold Info
[1]
Scaffold Name Tendamistat-based binder
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Alpha-amylase
BTS Info
Inhibitor Research tool N.A. Dupont-Merck Pharmaceutical Company [1]
Monoclonal antibody A8
BTS Info
Inhibitor Research tool N.A. Dupont-Merck Pharmaceutical Company [1]
References
1 Tendamistat as a scaffold for conformationally constrained phage peptide libraries. J Mol Biol. 1995 Jul 21;250(4):460-70.