General Information of Synthetic Binding Protein (SBP) (ID: SBP000730)
SBP Name
VNAR anti-HEWL Epi6
Synonyms
VNAR Epi6
Molecular Weight 11.5 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Selection Method Phage display
Highest Status Research
Sequence Length 106
SBP Sequence
>VNAR anti-HEWL Epi6
ARVDQTPQTITKETGESLTINCVLRDSNCVLSAGYWYRKPSGSTNEESISKGGRYVETVN
SGSKSFSLRINDLTVDDSGTYRCKPESRYGSYDADCAALNDGYGGG
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Protein Scaffold Information of This SBP
Scaffold ID PS065
Scaffold Info
[1]
Scaffold Name vNAR
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Hen egg-white lysozyme
BTS Info
Binder Research tool Kd: 8.5 nM University of Maryland [1]
References
1 First molecular and biochemical analysis of in vivo affinity maturation in an ectothermic vertebrate. Proc Natl Acad Sci U S A. 2006 Feb 7;103(6):1846-51.