Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000723) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
VNAR anti-HEWL clone 951-1
|
|||||
| Synonyms |
vNAR clone 951-1
|
|||||
| Molecular Weight | 13.1 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli BLT5403 | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 120 | |||||
| SBP Sequence |
>VNAR anti-HEWL clone 951-1
MLGDPNSAHVDQTPRVATKETGESLTINRVLRGASCGLYATRWFRQNPGSTSWERITIGG RYVESVNKGSKSFSLQIKDLTVEDSVTFYCKAMSVNIGPIECLTDTPYCHDGTGTVLTVN |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | vNAR HEL-5A7 | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS065 | [1] | ||||
| Scaffold Name | vNAR | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Hen egg-white lysozyme | Binder | Research tool | N.A. | Gyeongsang National University | [1] | |