Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000718) | ||||||
---|---|---|---|---|---|---|
SBP Name |
VNAR anti-HEWL clone 754-2
|
|||||
Synonyms |
vNAR clone 754-2
|
|||||
Molecular Weight | 13.0 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli BLT5403 | |||||
Selection Method | Phage display | |||||
Highest Status | Research | |||||
Sequence Length | 119 | |||||
SBP Sequence |
>VNAR anti-HEWL clone 754-2
MLGDPNSAHVDQTPRVATKETGESLTINCALRGAICGLYATSWFRQNPGSTGWERITIGG RYVESVNKGSKSFSLQIKDLTVEDSVTFYCKATLLFILLCIALLSLLLAMMGLDRADCE |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | vNAR HEL-5A7 | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS065 | [1] | ||||
Scaffold Name | vNAR | |||||
Scaffold Class | Antibody fragment | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Hen egg-white lysozyme | Binder | Research tool | N.A. | Gyeongsang National University | [1] | |