Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000711) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
VNAR anti-AMA1 12Y-2
|
|||||
| Synonyms |
VNAR 12Y-2
|
|||||
| Molecular Weight | 12.5 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 113 | |||||
| SBP Sequence |
>VNAR anti-AMA1 12Y-2
AWVDQTPRTATKETGESLTINCVLRDASFELKDTGWYRTKLGSTNEQSISIGGRYVETVN KGSKSFSLRISDLRVEDSGTYKCQAFYSLPLGDYNYSLLFRGEKGAGTALTVK |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS065 | [1] , [2] | ||||
| Scaffold Name | vNAR | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||