Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP000711)
SBP Name
VNAR anti-AMA1 12Y-2
Synonyms
VNAR 12Y-2
Molecular Weight 12.5 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Phage display
Highest Status Research
Sequence Length 113
SBP Sequence
>VNAR anti-AMA1 12Y-2
AWVDQTPRTATKETGESLTINCVLRDASFELKDTGWYRTKLGSTNEQSISIGGRYVETVN
KGSKSFSLRISDLRVEDSGTYKCQAFYSLPLGDYNYSLLFRGEKGAGTALTVK
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Protein Scaffold Information of This SBP
Scaffold ID PS065
Scaffold Info
[1] , [2]
Scaffold Name vNAR
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Apical membrane antigen 1
BTS Info
Inhibitor Malaria [ICD-11: 1F4Z] Kd: 300 nM CSIRO Health Sciences and Nutrition [1] , [2]
References
1 Structure of an IgNAR-AMA1 complex: targeting a conserved hydrophobic cleft broadens malarial strain recognition. Structure. 2007 Nov;15(11):1452-66.
2 Selection and affinity maturation of IgNAR variable domains targeting Plasmodium falciparum AMA1. Proteins. 2004 Apr 1;55(1):187-97.