Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000666) | ||||||
---|---|---|---|---|---|---|
SBP Name |
alphaRep protein anti-Alpha-tubulin iiH5
|
|||||
Synonyms |
alphaRep protein iiH5
|
|||||
Molecular Weight | 17.3 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli BL21 (DE3) | |||||
Selection Method | Phage display | |||||
Highest Status | Research | |||||
PDB ID | 6GWD | |||||
Sequence Length | 157 | |||||
SBP Sequence |
>alphaRep protein anti-Alpha-tubulin iiH5
EKVEMYIKNLQDDSPPVRFNAAVALGKIGDERAVEPLIKALKDEDWQVRKTAAYALGKIG DERAVEPLIKALKDEDRYVRSRAALALGKIGDERAVEPLIKALKDEDEYVRLSAASALGK IGGERVRAAMEKLAETGTGFARKVAVNYLETHKSLIS |
|||||
3D Structure | ||||||
Experimentally Validated Structure | ||||||
Click to Save PDB File | ||||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS009 | [1] | ||||
Scaffold Name | Alpha-Rep protein | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Alpha-Helices + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Tubulin alpha-1A chain | Binder | Research tool | Kd: 95 nM | Institute for Integrative Biology of the Cell (I2BC) | [1] | |