Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000644) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Affitin anti-HEWL M2
|
|||||
| Synonyms |
Affitin M2
|
|||||
| Molecular Weight | 7.9 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Highest Status | Research | |||||
| Sequence Length | 69 | |||||
| SBP Sequence |
>Affitin anti-HEWL M2
GSVKVKFFWNGEEKEVDTSKIVWVKRAGKSVIWIYDDNGKNGYGDVTEKDAPKELLDMLA RAEREKKLN |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Affitin H4 | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS007 | [1] | ||||
| Scaffold Name | Affitin | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | One Alpha-Helix + Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Hen egg-white lysozyme | Binder | Research tool | Kd: 440 nM | Angel University; Nantes University | [1] | |