Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000636) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Affitin anti-IgG D1Sso7d (E36L)
|
|||||
Synonyms |
Affitin D1Sso7d (E36L)
|
|||||
Molecular Weight | 7.4 kDa | |||||
Thermal Denaturation TEMP | 74.1 ℃ | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli | |||||
Highest Status | Research | |||||
Sequence Length | 64 | |||||
SBP Sequence |
>Affitin anti-IgG D1Sso7d (E36L)
MATVKFKYKGEEKEVDISKIKKVWRDRLAAVFTYDLGGGKTGYGWVFTKDAPKELLQMLE KQKK |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | Sac7d | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS007 | [1] | ||||
Scaffold Name | Affitin | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | One Alpha-Helix + Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Immunoglobulin G | Binder | Tools for enhancing pH stability | Kd: 300 nM | Nantes University | [1] | |