General Information of Synthetic Binding Protein (SBP) (ID: SBP000635)
SBP Name
Affitin anti-IgG D1Sso7d (K13L)
Synonyms
Affitin D1Sso7d (K13L)
Molecular Weight 7.4 kDa
Thermal Denaturation TEMP 69.5 ℃
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Highest Status Research
Sequence Length 64
SBP Sequence
>Affitin anti-IgG D1Sso7d (K13L)
MATVKFKYKGEELEVDISKIKKVWRDRLAAVFTYDEGGGKTGYGWVFTKDAPKELLQMLE
KQKK
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Sac7d
Protein Scaffold Information of This SBP
Scaffold ID PS007
Scaffold Info
[1]
Scaffold Name Affitin
Scaffold Class Non-Antibody
Fold Type One Alpha-Helix + Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Immunoglobulin G
BTS Info
Binder Tools for enhancing pH stability Kd: 300 nM Nantes University [1]
References
1 Switching an anti-IgG binding site between archaeal extremophilic proteins results in Affitins with enhanced pH stability. J Biotechnol. 2014 Dec 20;192 Pt A:123-9.