Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP000570)
SBP Name
Cyclotide anti-CXCR4 MCo-CVX-5c
Synonyms
Cyclotide MCo-CVX-5c
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Highest Status Research
Sequence Length 43
SBP Sequence
>Cyclotide anti-CXCR4 MCo-CVX-5c
VCPKILQRCRRDSDCPGACICRGNGYCGSYRXCRGpRRBCYXK
Sequence Description Cys I and Cys IV form disulfide bonds; Cys II and Cys V form disulfide bonds; Cys III and Cys VI form disulfide bonds; MCo-CVX-5c is the C-to-N cyclized peptides; Single letter codes B, X and p represent the amino acid, 2-naphthylalanine, citruline and D-proline, respectively.
Template Name MCoTI-I
Template Sequence Description Cys I and Cys IV form disulfide bonds; Cys II and Cys V form disulfide bonds; Cys III and Cys VI form disulfide bonds.
Protein Scaffold Information of This SBP
Scaffold ID PS023
Scaffold Info
[1]
Scaffold Name Cyclotide
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
C-X-C chemokine receptor type 4
BTS Info
Antagonist Human immunodeficiency virus type 1 infection [ICD-11: XN8LD]; Cancers [ICD-11: 2D4Z] N.A. University of Southern California [1]
References
1 Design of a novel cyclotide-based CXCR4 antagonist with anti-human immunodeficiency virus (HIV)-1 activity. J Med Chem. 2012 Dec 13;55(23):10729-34.