Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000566) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Cyclotide anti-MAS1 MCo-AT1-7
|
|||||
| Synonyms |
Cyclotide MCo-AT1-7
|
|||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Highest Status | Research | |||||
| Sequence Length | 38 | |||||
| SBP Sequence |
>Cyclotide anti-MAS1 MCo-AT1-7
GGVCPKILQRCRRDSDCPGACICRGNGYCGSGXRVYIE |
|||||
| Sequence Description | Cys I and Cys IV form disulfide bonds; Cys II and Cys V form disulfide bonds; Cys III and Cys VI form disulfide bonds; MCo-AT1-7 is the C-to-N cyclized peptides; Residue X represents L-2,3-diaminopropionic acid. | |||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | MCoTI-II | |||||
| Template Sequence Description | Cys I and Cys IV form disulfide bonds; Cys II and Cys V form disulfide bonds; Cys III and Cys VI form disulfide bonds. | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS023 | [1] | ||||
| Scaffold Name | Cyclotide | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Proto-oncogene Mas | Activator | Cancers [ICD-11: 2D4Z]; Myocardial infarction [ICD-11: BA41] | N.A. | University of Southern California | [1] | |