General Information of Synthetic Binding Protein (SBP) (ID: SBP000511)
SBP Name
Affibody anti-Raf-1 Z(RAF322)
Synonyms
Affibody Z(RAF322)
Molecular Weight 6.5 kDa
Thermal Denaturation TEMP 47.5 ℃
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli Rosetta (DE3)
Selection Method Ribosome display
Highest Status Research
Sequence Length 58
SBP Sequence
>Affibody anti-Raf-1 Z(RAF322)
VDNKFNKEVNLAADEIWLLPNLNNQQAWAFITSLKDDPSQSANLLAEAKKLNDAQAPK
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Z domain of staphylococcal protein A
Protein Scaffold Information of This SBP
Scaffold ID PS004
Scaffold Info
[1]
Scaffold Name Affibody
Scaffold Class Non-Antibody
Fold Type Three Alpha-Helices
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
RAF proto-oncogene serine/threonine-protein kinase
BTS Info
Inhibitor Tools for monitoring whole gene in vitro Kd: 1900 nM Royal Institute of Technology [1]
References
1 Monitored whole gene in vitro evolution of an anti-hRaf-1 affibody molecule towards increased binding affinity. N Biotechnol. 2012 Jun 15;29(5):534-42.