Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000508) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Affibody anti-FcRn/FcRn Z(FcRn_4)
|
|||||
Synonyms |
Affibody Z(FcRn_4)
|
|||||
Molecular Weight | 6.6 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli BL21 (DE3) | |||||
Selection Method | Phage display | |||||
Highest Status | Research | |||||
Sequence Length | 58 | |||||
SBP Sequence |
>Affibody anti-FcRn/FcRn Z(FcRn_4)
VDAKYAKEFESAAHEIRWLPNLTYDQRVAFIHKLSDDPSQSSELLSEAKKLNDSQAPK |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS004 | [1] | ||||
Scaffold Name | Affibody | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Three Alpha-Helices | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Fc receptor | Binder | Tools for extending circulatory half-life | Kd: 50 nM | Royal Institute of Technology | [1] | |
Fc receptor | Binder | Tools for extending circulatory half-life | Kd: >1000 nM | Royal Institute of Technology | [1] | |