General Information of Synthetic Binding Protein (SBP) (ID: SBP000497)
SBP Name
Affibody anti-ERBB3 Z(05416)
Synonyms
Affibody Z(05416)
Molecular Weight 6.6 kDa
Thermal Denaturation TEMP 61 ℃
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli BL21 (DE3)
Selection Method Phage display and Staphylococcal surface display
Highest Status Research
Sequence Length 58
SBP Sequence
>Affibody anti-ERBB3 Z(05416)
VDNKFNKEKYTAYFEIWQLPNLNVRQKAAFISSLQDDPSQSANLLAEAKKLNDAQAPK
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Z domain of staphylococcal protein A
Protein Scaffold Information of This SBP
Scaffold ID PS004
Scaffold Info
[1]
Scaffold Name Affibody
Scaffold Class Non-Antibody
Fold Type Three Alpha-Helices
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Receptor tyrosine-protein kinase erbB-3
BTS Info
Binder Cancers [ICD-11: 2D4Z] Kd: 2.9 nM Royal Institute of Technology [1]
References
1 Combining phage and staphylococcal surface display for generation of ErbB3-specific Affibody molecules. Protein Eng Des Sel. 2011 Apr;24(4):385-96.