Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP000489)
SBP Name
Affibody anti-EBV Z(LMP2A-N)110
Synonyms
Affibody Z(LMP2A-N)110
Molecular Weight 6.5 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli BL21 (DE3)
Selection Method Phage display
Highest Status Research
Sequence Length 58
SBP Sequence
>Affibody anti-EBV Z(LMP2A-N)110
VDNKFNKECWLAQKEIRGLPNLNLVQVRAFILSLHDDPSQSAELLAEAKKLNDAQAPK
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Z domain of staphylococcal protein A
Protein Scaffold Information of This SBP
Scaffold ID PS004
Scaffold Info
[1]
Scaffold Name Affibody
Scaffold Class Non-Antibody
Fold Type Three Alpha-Helices
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Latent membrane protein 2
BTS Info
Inhibitor Imaging agent for patients with nasopharyngeal carcinoma Kd: 5360 nM Wenzhou Medical University [1]
References
1 Generation of novel affibody molecules targeting the EBV LMP2A N-terminal domain with inhibiting effects on the proliferation of nasopharyngeal carcinoma cells. Cell Death Dis. 2020 Apr 1;11(4):213.