Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00020) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
Latent membrane protein 2
|
|||||
| Synonyms |
Terminal protein
|
|||||
| BTS Type |
Protein
|
|||||
| Family |
Herpesviridae LMP-2 family
|
|||||
| Gene Name |
LMP2
|
|||||
| Organism |
Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)
|
|||||
| Function |
Isoform LMP2A maintains EBV latent infection of B-lymphocyte, by preventing lytic reactivation of the virus in response to surface immunoglobulin (sIg) cross-linking. Acts like a dominant negative inhibitor of the sIg-associated protein tyrosine kinases, LYN and SYK. Also blocks translocation of the B-cell antigen receptor (BCR) into lipid rafts, preventing the subsequent signaling and accelerated internalization of the BCR upon BCR cross-linking. Serves as a molecular scaffold to recruit SYK, LYN and E3 protein-ubiquitin ligases, such as ITCH and NEDD4L, leading to ubiquitination and potential degradation of both tyrosines kinases. Possesses a constitutive signaling activity in non-transformed cells, inducing bypass of normal B lymphocyte developmental checkpoints allowing immunoglobulin-negative cells to colonize peripheral lymphoid organs.; Isoform LMP2B may be a negative regulator of isoform LMP2A.
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Gene ID | ||||||
| Sequence |
MGSLEMVPMGAGPPSPGGDPDGYDGGNNSQYPSASGSSGNTPTPPNDEERESNEEPPPPY
EDPYWGNGDRHSDYQPLGTQDQSLYLGLQHDGNDGLPPPPYSPRDDSSQHIYEEAGRGSM NPVCLPVIVAPYLFWLAAIAASCFTASVSTVVTATGLALSLLLLAAVASSYAAAQRKLLT PVTVLTAVVTFFAICLTWRIEDPPFNSLLFALLAAAGGLQGIYVLVMLVLLILAYRRRWR RLTVCGGIMFLACVLVLIVDAVLQLSPLLGAVTVVSMTLLLLAFVLWLSSPGGLGTLGAA LLTLAAALALLASLILGTLNLTTMFLLMLLWTLVVLLICSSCSSCPLSKILLARLFLYAL ALLLLASALIAGGSILQTNFKSLSSTEFIPNLFCMLLLIVAGILFILAILTEWGSGNRTY GPVFMCLGGLLTMVAGAVWLTVMSNTLLSAWILTAGFLIFLIGFALFGVIRCCRYCCYYC LTLESEERPPTPYRNTV |
|||||
| Sequence Length |
497
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| Affibody anti-EBV Z(EBV)12 | Research | Binder | Kd: 1450 nM | Nasopharyngeal carcinoma [ICD-11: 2B6B.Y] | [1] | |
| Affibody anti-EBV Z(EBV)132 | Research | Binder | Kd: 3740 nM | Nasopharyngeal carcinoma [ICD-11: 2B6B.Y] | [1] | |
| Affibody anti-EBV Z(EBV)137 | Research | Binder | Kd: 3900 nM | Nasopharyngeal carcinoma [ICD-11: 2B6B.Y] | [1] | |
| Affibody anti-EBV Z(EBV)142 | Research | Binder | Kd: 1140 nM | Nasopharyngeal carcinoma [ICD-11: 2B6B.Y] | [1] | |
| Affibody anti-EBV Z(LMP2A-N)110 | Research | Inhibitor | Kd: 5360 nM | Imaging agent for patients with nasopharyngeal carcinoma | [2] | |
| Affibody anti-EBV Z(LMP2A-N)252 | Research | Binder | Kd: 2760 nM | Imaging agent for patients with nasopharyngeal carcinoma | [2] | |
| Affibody anti-EBV Z(LMP2A-N)85 | Research | Binder | Kd: 1670 nM | Imaging agent for patients with nasopharyngeal carcinoma | [2] | |
| References |
|---|