Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000466) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Affibody anti-EBV Z(EBV)142
|
|||||
| Synonyms |
Affibody Z(EBV)142
|
|||||
| Molecular Weight | 6.5 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 58 | |||||
| SBP Sequence |
>Affibody anti-EBV Z(EBV)142
VDNKFNKEALRARGEIAWLPNLNEEQDEAFIPSLHDDPSQSAELLAEAKKLNDAQAPK |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Z domain of staphylococcal protein A | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS004 | [1] | ||||
| Scaffold Name | Affibody | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Three Alpha-Helices | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Latent membrane protein 2 | Binder | Nasopharyngeal carcinoma [ICD-11: 2B6B.Y] | Kd: 1140 nM | Wenzhou Medical University | [1] | |