Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP000460)
SBP Name
Affibody anti-CD28 Z(CD28:5)
Synonyms
Affibody Z(CD28: 5)
Molecular Weight 6.3 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Phage display
Highest Status Research
Sequence Length 58
SBP Sequence
>Affibody anti-CD28 Z(CD28:5)
VDNKFNKEARAARIEITPLPNLNREQGGAFIVSLKDDPSQSANLLAEAKKLNDAQAPK
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Z domain of staphylococcal protein A
Protein Scaffold Information of This SBP
Scaffold ID PS004
Scaffold Info
[1]
Scaffold Name Affibody
Scaffold Class Non-Antibody
Fold Type Three Alpha-Helices
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
T-cell-specific surface glycoprotein CD28
BTS Info
Inhibitor Tools for inhibiting the CD28-CD80 co-stimulation signal Kd: 8500 nM Royal Institute of Technology [1]
References
1 Inhibition of the CD28-CD80 co-stimulation signal by a CD28-binding affibody ligand developed by combinatorial protein engineering. Protein Eng. 2003 Sep;16(9):691-7.