Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000428) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Fynomer anti-ERBB3 C12
|
|||||
| Synonyms |
Fynomer C12
|
|||||
| Molecular Weight | 7.2 kDa | |||||
| Thermal Denaturation TEMP | 74 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Chinese hamster ovary cells | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 63 | |||||
| SBP Sequence |
>Fynomer anti-ERBB3 C12
GVTLFVALYDYTSYNTRDLSFHKGEKFQILRMEDGVWWEARSLTTGETGYIPSNYVAPVD SIQ |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Fyn SH3 domain | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS035 | [1] | ||||
| Scaffold Name | Fynomer | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Receptor tyrosine-protein kinase erbB-3 | Binder | Cancers [ICD-11: 2D4Z] | Kd: 80 nM | Covagen AG | [1] | |