Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP000415)
SBP Name
Centyrin anti-TNF-alpha P191-22
Synonyms
Centyrin P191-22
Molecular Weight 9.6 kDa
Thermal Denaturation TEMP 45.6-87.3 ℃
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method CIS display
Highest Status Research
Sequence Length 89
SBP Sequence
>Centyrin anti-TNF-alpha P191-22
LPAPKNLVVSRVTEDSARLSWTAPDAAFDSFYILYWEFATAGEAIVLTVPGSERSYDLTG
LKPGTEYMVLIRGVKGGTRSSPLSAIFTT
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Tencon
Protein Scaffold Information of This SBP
Scaffold ID PS020
Scaffold Info
[1]
Scaffold Name Centyrin
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Tumor necrosis factor
BTS Info
Inhibitor Research tool Kd: 1.2 nM Janssen Research & Development, L.L.C. [1]
References
1 Selection of high-affinity Centyrin FN3 domains from a simple library diversified at a combination of strand and loop positions. Protein Eng Des Sel. 2014 Oct;27(10):419-29.